PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00111.1_g00021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 256aa    MW: 29266.2 Da    PI: 8.4771
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00111.1_g00021.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.12.1e-50141351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yL++kv+g +l++ +vi+e+di+k++PwdLp      e+e yfFs+r+ ky++g+r+nr+t sgyWkat
  Rsa1.0_00111.1_g00021.1  14 LPPGFRFHPTDEELVVQYLCRKVTGLPLPA-SVIPEIDICKADPWDLPGD---CESERYFFSTREAKYPNGNRSNRSTCSGYWKAT 95 
                              79****************************.99***************44...46799**************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++    ++lvg+kktLvfykg+ p+g++t+Wv+heyrl
  Rsa1.0_00111.1_g00021.1  96 GIDKQIGG--KKLVGMKKTLVFYKGKPPNGTRTNWVLHEYRL 135
                              ******87..899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-5810157IPR003441NAC domain
PROSITE profilePS5100557.114157IPR003441NAC domain
PfamPF023654.2E-2615135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEKISSIKSR GLKLPPGFRF HPTDEELVVQ YLCRKVTGLP LPASVIPEID ICKADPWDLP  60
GDCESERYFF STREAKYPNG NRSNRSTCSG YWKATGIDKQ IGGKKLVGMK KTLVFYKGKP  120
PNGTRTNWVL HEYRLLDSQQ ESHGENTDWV LCRVFLKKTS NANSNKRKED EKERKEEKES  180
DKDDNKSACP IFYDFLRKDK KRKRCCDLNV TPTCCCCSAS ASSSVCSSAL TQTSTHNDSD  240
YHEEITCREI KFCLFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-561216018171NAC domain-containing protein 19
3swp_C4e-561216018171NAC domain-containing protein 19
3swp_B4e-561216018171NAC domain-containing protein 19
3swp_A4e-561216018171NAC domain-containing protein 19
3swm_D4e-561216018171NAC domain-containing protein 19
3swm_C4e-561216018171NAC domain-containing protein 19
3swm_B4e-561216018171NAC domain-containing protein 19
3swm_A4e-561216018171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634266.11e-164PREDICTED: NAC domain-containing protein 41-like
SwissprotO227981e-114NAC41_ARATH; NAC domain-containing protein 41
TrEMBLA0A078GB991e-164A0A078GB99_BRANA; BnaC04g43920D protein
TrEMBLA0A0D3C3Y11e-164A0A0D3C3Y1_BRAOL; Uncharacterized protein
STRINGBra021856.1-P1e-155(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18062786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33480.11e-106NAC domain containing protein 41